ValidNESs:

Validated NES-containing proteins, functional NES sites and NES predictions

Home
NES-containing regions
NES-containing proteins
NES prediction

 Input the UniProt ID

  e.g. IPKA_HUMAN

  

  

 Or protein sequence in one-letter code

  e.g. MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES

  

  

  Please input UniProt ID or the sequence of your protein



 Related links

  NESsential requires two useful outside predictors for feature calculation:

  SABLE Website Standalone version license

  POODLE-L Website Standalone version copyright

  If you find NESsential useful and want to apply it in large-scale screening, you can download the stanalone version here