ValidNESs:

Validated NES-containing proteins, functional NES sites and NES predictions

Home
NES-containing regions
NES-containing proteins
NES prediction

 Display by category

  Choose type of NESs from the drop-down list
  Classical NESs if the experimental validated region overlaps with a short NES motif, otherwise Non-classical More details in documentation

  



 Search by pattern

  Try L[A-Z]{2,3}L[A-Z]L to retrieve NES sites containing this pattern: Lx(2,3)LxL
  x can be any amino acid while the spacing between 1st and 2nd leucine can be 2 or 3 More details in documentation

   

  



 Data retrieved

  Total 262 NES sites

  Download data in text file format



 Experimentally validated NES sites

 *point-mutations that impair NES activity either alone or together are marked in red

ACCSEQUENCE AND POSITION
OF NES-CONTAINING REGION
REFERENCE DB
(UniProt)
REFERENCE DB
(PDB)
VALIDATED BY
LEPTOMYCIN TREATMENT
REFERENCE
(PMID)
S00138-LALKLAGLDI-47P619252L1L
Yes7634336 10739668
S002339-EMFRELNEALELKD-352P046371AIE
Yes10075936 11397945 11847229
S003188-SISLSFDESLALCVI-202Q00987--9430646 11397945
S004137-GIDLSGLTLQ-146Q9W639-Yes11265759
S005835-ESLEEELDVLVLDDEGG-851O60716-18-Yes10393933
S006331-DKERWEDVKEEMTSALATMRVDYE-354P49138-Yes9628873
S0071078-EAINKLESNLRELQICPAT-1096P00520-Yes9636171
S008141-DLCQAFSDVILAV-153P14635-Yes9582266
S009170-SLPHAILRIDLA-181P600101YAG
Yes9501085
S010211-DIKEKLCYVALD-222P60010-Yes9501085
S01175-LPPLERLTL-83P05865-Yes7543368 10739668
S01281-ALSAQLYSSLSLDS-94Q82233 --8754820
S01333-LQKKLEELELDEQ-45Q05116-Yes8702720 9384386
S014766...LELAIALSKSEI...896P42566-Yes11777906
S01522-LECPICLEL-30P383981JM7
Yes15811849
S01681-QLVEELLKIICAFQLDTGL-99P383981JM7
Yes10991937
S017436-LSEALLQLQF-445Q04206-Yes10490645
S018328-EDLVVKTPEWGEELQDLVDQLGFL-351P41152-Yes11238913
S019515-ESFDIDDLCSKLKNKAKCS-533Q01663-Yes10329722
S020197-LLLKKMYLM-205P422241BF5
Yes10982844
S021336-LCLSDLSLL-344Q14872-Yes11306562
S022575-EAALSDALAALQIE-588P11484--10347213
S023350-ALPLGKLTL-358Q123153PEV
-8848052
S02476-LKVIEENVCPKPAQVEPSSPSPMETSGCLPDELCQAFSDVLIHVKDVDAD-125P13350-Yes9679058
S025485-DIQELSEQIHRLLL-498O35973-Yes11591712
S026164-ELKDFLKELNIQVD-177P106881DJX
Yes10497218
S02783-LYPELRRILTI-93P03243-Yes10702793
S028233-LDRKLLELLW-242O35864-Yes11704659
S0291...LSAIYESL...101P47973-Yes12054509
S03022...MVKELQEIRL...72P25963-Yes10581242
S031178-EKVAEKLEALSVKEETKE-195P43487-Yes9111043 10779340
S032136-QEDILDELLGNMVLA-150Q14653-Yes9463386
S033364-NFEILMKLKESLELMELVP-382O153502WQI
Yes11847229
S034406-LTKMCTIRM-414Q157971KHU
Yes11509558
S035380-LSGLHL-385Q9BY84-Yes11489891
S036250-LQDFDL-255Q62074-Yes11115515
S037143-LSGLTL-148Q13485-Yes11265759
S038204-LEELDL-209P14373-Yes11591718
S039301-LNARLTI-307P46934-4 -Yes11342538
S040616-VDGLC-620P198801SSE
-9857197
S04116-FAGLDL-21P24346--10454574
S04247-LTPVTDLAVGF-57P30309-Yes10323858
S043342-LSLCDVDI-349P30309-Yes10323858
S04468-LLERLKELNL-77P25054-Yes11035805
S045165-LTKRIDSLPL-174P250541M5I
Yes11035805
S046120-VATELGILGM-129Q9JJT9--10786834
S04794-LRELQL-99Q9WTZ9-Yes11830582
S048660...LVDSLHDLTI...747Q04377-Yes11027275
S04914-MKKMAI-19P08014--11462009
S05016-MSKMQL-21P03508--9427762
S051486-FDDLKI-491O00221-Yes11970947
S0521...LIPLLERLDL...164P54824-Yes11839790
S053831...LFGVLRL...1132O14746-Yes10835362
S054316-EKGNLPELEKLEINGNRL-333P11745--9885287
S055329-NGNRLDEDSDALDLLQSKFDDLEVDDFEE-357P11745--9885287
S056321-QPDASKADPLPVLENLTLK-339P34694--8610146
S057347-NKPSGTETNGSLVLDKLTIQ-366P03001--8610146 10402428
S05855-PFPQDVINKLDKLSVLRLSVS-75P35869--9446600
S059382...LTEQIHRLLM...469O549433GDI
Yes11591712
S060128-LTELEISSIFSHCC-141Q91UL8-Yes11238866
S061319-LTMKEVEELELLTQKLM-335Q04584--9281590
S0621-MAEYDLTTRIAHFLDRHLVF-20P60228--10644362
S063154-SILPKSGEPKLFLPVPS-170P13199--10559371
S0641...ILAALTL...77Q061422BPT
-9151683
S065177...LLIDL...256P21935--10402428
S066425-KEVDQLRLERLQIDEQL-441Q06787--8842725
S0675-IDMLIDLGLDLSD-17P10238--9512520
S068138-FDRLETLILL-147P03494--9560194
S06945-LLSQDLEPLALSD-57Q9I959--10880959
S070255-LPLTLFPSANL-265Q13642--10480922
S071229-RQSLAQELGLNESQIKIWFQ-248Q05917--10375508
S072445-DYELFLQELEED-456P38861-Yes11086007 11313466
S073492-NIDELLDELDEM-503P38861-Yes11086007 11313466
S074369-LTDMAGTMNL-378O43524-Yes11864996
S075386-LMDDLLDNITL-396O43524-Yes11864996
S0761081...VSAMALLSV...1122Q9UQL6-Yes11509672
S0771044-EAQTCENEEAETVTAMASLSVGVKPA-1069P56524-Yes11509672 11486037
S07865-LEGIGL-70Q162541CF7
Yes11158323
S07997-LI-98Q16254-Yes11158323
S080222-IMQLL-226P42656--9923681
S081365-LGTMVI-370Q13043-Yes11805089
S082439-WTVEDL-444Q130432JO8
Yes11805089
S08399-LIHL-102P22149--11877447
S084218-PVSKITFVTL-227Q04360-Yes11543664
S085227-LPSPLASLTL-236Q04360-Yes11543664
S0861-ALTVEELGLS-10P0CA03-Yes16415017
S087139-IDSIQTVQQM-148P0CA03-Yes16415017
S088225-LNNLDPELKNL-235O00401-Yes12871950
S089393-LLSGVDDISI-402O60729-Yes15917648
S09089-VKKQMEELTV-98O702011M4M
Yes16984408 17099693
S0911-MPSDFISLLSADLDLESPK-19O94916-Yes16782704
S092189-KRIEELLYKISLTT-202P03409-Yes16285885
S09342-LSLRTVSL-49P067482P1B
Yes16648475
S09494-ITPPVVLRL-102P067482P1B
Yes16455950 16501600 16041368
S095128-LPPRLALRLR-137P08353-Yes12186925
S096394-LDVTPLSL-401P11142-Yes14684748
S097405-VAQLKQLLL-413P153361T2K
Yes16511568
S098241-NLREISQLGISGDITL-256P16110-Yes16473835
S099228-LSLNLFALRI-237P16727-Yes17005707
S100359-LTLSSLTL-366P16727-Yes17005707
S101186-ISPWILAVLTLQIQSLISCWAFW-208P17861-Yes16461360
S10241-PRELIFQVWRRSWEYWHDEM-60P19508-Yes16987982
S10391-VIDYIRDLQLEL-102P20067-Yes16516211 17412691
S104367-ITGLADSLQL-376P219522XSD
Yes16260476
S10549-LPEDMKRLHL-58P22363-Yes15780878
S106127-ELCDIAAILG-136P28289-Yes15123707
S107485-LSAYLTLFVAL-495P30021-Yes17005680
S108173-LWVRLYVLEL-182P38483-Yes12881431
S109535-IQDGLLKMLSLVL-547P42345-Yes16407298
S110975-ITFIFKSLGL-984P42345-Yes16407298
S1111281-LEWLRRLSL-1289P42345-Yes16407298
S1122397-IIISLARLPL-2406P42858-Yes12783847
S1132-QLEIQVALNFIIS-14P506162Z15
Yes15051490
S11447-LRLGSQLSL-55P596362CME
Yes17448558
S115149-LFDYLPLTAL-158P677752IE4
Yes16964287
S116152-LDLRDLFQL-160P97318-21NTV
Yes17062576
S117462-FDISQLNL-469P97318-2-Yes17062576
S118132-LGQLPKQLARLS-143Q02085-Yes12832491
S119272...LVKIFEELTL...312Q14145-Yes15899855
S120251-LSLEECLRLL-260Q14494-Yes12729924
S121613-LTLLKTNLNL-622Q14678-Yes16968744
S122175-LLSIPELQCLNI-186Q16236-2-Yes16790425
S123537-LKKQLSTLYL-546Q16236-2-Yes15917227
S124240-QLEKRLSLLS-249Q18PE1-Yes18165682
S125372-LQNFLTIL-379Q5EBH1-Yes18211824
S126545-LKRRLSTLYL-554Q60795-Yes15901726
S127607-LGRDLLNMYIE-617Q61699-Yes17643418
S1282415-LAAIVDAIKL-2424Q6UB99-Yes17286281
S12941-LRNLFSQTLSL-51Q8IXJ6-Yes17726514
S130284-LEDVSVDV-291Q8K3Y6-Yes15358138
S13195-RLERLQEILRKFLYL-109Q8N720-Yes15558030
S132305-LRLGSQIFI-313Q95168-Yes16920099
S133719-LFGPIADIAL-728Q95168-Yes16920099
S134728-LEKLANELPDL-738Q95168-Yes16920099
S135199-TRQKLWRSLKMLP-211Q96JZ2-Yes16169852
S136634-SQMLSKEVDACVTDLLKELVRFQD-657Q96T21-Yes16782878
S137756-QDQFHKMVELTVAAR-770Q96T21-Yes16782878
S13837-IAGITITLSL-46Q99152-Yes16840333
S139128-LCSHFRELSI-137Q99MU3-Yes14711814
S140631-LEQELQQLSLEL-642Q9BRK4-Yes17000760
S141142-LSDDELKHLIL-152Q9EPW1-Yes16980631
S142361-LAYLPQELL-369Q9EPW1-Yes16980631
S143190-RDAFRTLGL-198Q9GZX7-Yes14769937
S144317-LEPDLSEEVSARLRLG-332Q9HC62-Yes16738331
S145152-LVSFQKLKL-160Q9PWE8-Yes18160705
S146237-LANVNLMLELL-247Q9R1A8-Yes12466024
S14770-LLRLGDELE-78Q9UMX3-Yes16302269
S148355-ILSGLDDMSI-364Q9UNH5-Yes15917648
S149255-LEGLKELMQL-264Q9Y572-Yes15208320
S150344-MVSEWLNKLNL-354Q9Y572-Yes15208320
S151382-LLSQFGFMQV-391Q9Z2A0-Yes14623982
S15220-LRNVQRLAL-28C8ZJE1--17033818
S153297-LVQLDKLQL-305C8ZJE1--11171327 17033818
S154100-LIMKSKLPYAVEL-112O92398-Yes16483627
S155145-MKTMMETMKLMMEKVDLLYAS-165Q5GLC3-Yes16414989
S156189-LRDALKLLGF-198Q75R42-Yes16785531
S157551-MVPLVIKLRL-560Q99AM3-Yes16214130
S15876-LEKAMTTLKL-85Q9YZN9-Yes17303464
S1591017-DILRDFFELRLK-1028P11388-Yes12821127 15173319
S1601054-FILEKIDGKIIIE-1066P11388-Yes12821127
S1611383-DLSDLTFLEVA-1393P51587-Yes18059333
S1621039-ILKEFFDLRLS-1049Q02880-Yes12821127
S1634-INQMFSVQLSL-14Q68SB1-2-Yes15364930
S16482-MTKKFGTLTI-91Q83414-Yes18385513
S16541-DLQLERINVY-50P025541JFF
Yes19299461
S166145-ILFLPLPV-152P052301JQZ
Yes17616529
S16768-VRGLGLPKLYL-78P38936-Yes17477906
S168102-LQGTAEEDHVDLSLSCTL-119P38936-Yes17477906
S169306-LEIVHDLENLSL-317P53686-Yes17110954
S170434-LSDRSQWVFDGWNLVLPSVGAAIKIVVHGQFEEPQ-468Q9Y8G3--14963046
S171469-NKRLLRSFDRTLLILPGGSTGILIINDLLVIRSFAGSLGWL-509Q9Y8G3--14963046
S172341-FDPDIHCGVIDL-352O152652KKR
Yes16314424
S173453-WLYLEEMVNSLLNTAQQLKTLFEQ-476O75398-Yes15161925
S174216-GPALTDWARVREELAST-232P033221P7N
Yes16439536
S175259-KKVVKQASEGPLK-271P044061U8F
Yes14617633
S176162-LSDTSTTSLEL-172P12272-Yes16293661
S177204-LDRMLKSAAIRIL-216P30022-Yes16140763
S178169-LREVLEALED-178P34078-Yes16888326
S179851-LGNLQSL-857P34758--16251346
S180257-ITYLPAGQSVLLQL-270P35232-Yes16319068
S181349-LAALNHISAL-358Q09728-Yes17384198
S182271-LVCLAESCLTLE-282Q96AP0-Yes17562870
S183348-LLKAKLTDPKED-359Q99704-Yes16705178
S184156-GEMLFGLVRQGLK-168Q9BZL6-Yes15975900
S18561-LAANSLLNKLIRQS-74Q9QY16-Yes16968703
S186633-FMKEMEGLL-641Q9Y2W2-Yes16162498
S18732-LFGPVDHEELTRDL-45P465271JSU
Yes12529437 18991627
S188174-LVHLENKLSTTGLNPTAVP-192Q997F2-Yes15113915
S189148-LLPSLLNTL-156Q67684--15105550
S190272-IELTLRL-278Q9HBL82WM3
Yes22348310
S1911-MKFKLHV-7P15336-Yes22275354
S19286-LAERLSKMVI-95Q86TB9-Yes22090346
S193102-LCNCALEELRL-112P785452E8P
Yes21871131
S194275-LWEFIRDILI-284P78545-Yes21871131
S195451-REELWKKLEELKLKKALEK-469Q15172-Yes20378546
S196802-LVDKFMKLDL-811O43196-Yes20185565
S197299-LEELCAARRLSL-310Q01354 -Yes20109505
S19821-LSNLHSLDR-29Q9Y3M2-Yes19940019
S199362-LSTLDQLRL-370O08560-Yes20023381
S2005-LADLSVNLQV-14Q8VIP2--20025850
S20186-LTRLFECLSL-95Q8VIP2-Yes15163635
S202439-LLDLHIEL-446O155193H11
Yes20016063
S203175-PHKTFRKLRL-184P30291-Yes19858290
S2041-MDVLPMCSIFQELQIV-16Q99612-Yes20844588
S205245-LELEALRLSL-254O95613-Yes20567258
S2061158-LQDALRRLLGL-1168O95613-Yes20567258
S2071169-FGETLRAAVTL-1179O95613-Yes20567258
S2081540-LDEFNELAI-1548O95613-Yes20567258
S2091745-VIEKLQHELSL-1755O95613-Yes20567258
S21023-LMQQIENFEKI-33P048071IG8
-19525230
S211310-LGEILRLAL-318P048071IG8
-19525230
S212194-IIPYSGLLLVITV-206P034192VQP
Yes19297465
S21371-VIQALESLGF-80Q016581JFI
Yes19204005
S21495-LCLGLQSLSL-104Q9BZB8-Yes18923137
S215198-LSDLISSLRI-207Q9BZB8-Yes18923137
S216119-IPYSINMNVFLPDITHLRTGL-139Q9Z0Z7-Yes18782761
S217616...MEDIKILI...658Q16665-Yes18687685
S218418-LEKQINDLQIDK-429P39723--18573877
S219444-EFVCLKSIILLNS-456P033721XPC
Yes18644889
S22092-FMELSAALPL-101Q24167-Yes18332128
S221115-MRITIAFLKI-124Q24167-Yes18332128
S222238-LTDLTL-243Q14140-Yes18316374
S223409-LITFINALKL-418P031162V9P
Yes18201744
S22484-CAFLSVKKQFEELTLGEFLKLDRERA-109O153922QFA
Yes17714426
S225119-NKKKEFEETAEKVRRAIEQLAAMD-142O153922QFA
Yes17714426
S226458-LRKLCERLRG-467O00311-Yes17711849
S227545-LLDKLLDLNP-554O00311-Yes17711849
S228521-VRFFGLDLDS-530P36328-Yes17652399
S2291-MSTVHEILCKLSLEGDHSTPPSAYGSVKAY-30P07355-Yes17457518
S23089-VKKQFEELTL-98O15392-42QFA
Yes17582222
S231160...INTFMVLQV...210Q149941XVP
Yes17488649
S232244-FQYEFLELII-253Q9QUS1-Yes17488649
S233109-LKKLECLKSLDL-120Q926882ELL
-17178712
S2341651...LQEMPGDVPL...1681Q14674-Yes17102637
S235194-LHLVGVNV-201Q8BMI0-Yes16990251
S236369-LTNLLRQL-376Q9UDY83UOA
Yes16123224
S237474-IPILDAL-480Q9UDY83UOA
Yes16123224
S238272-YRDLKLENLMLDK-284P317493QKL
Yes15896313
S23937-FAITDLLGL-45O42250-Yes15767664
S240171-DTAGLLEKLTVEETKTEEKT-190Q9LMK7-Yes10652141
S241383-LCNLVSYLGI-392Q6VGU3--15220445
S24267-LRDKLKEQNF-76P24937--14633984
S243233-LNSIVGLGV-241P24937--14633984
S24470-VMLAVQEGIDL-80P03255-Yes17065226
S24583-MVLTREELVI-92Q2KRZ1--9250671
S246125-MQELSNILNL-134Q9H9S02KT0
Yes22516749
S247282-DLLASFTSLSL-292Q6NXT1-Yes22527282
S24855-CILCQLLLLY-64P16800-Yes22414299
S24911-VIKVFNDMKV-20P235281Q8G
Yes22623727
S250248-PGNAEFEDLIFLARSALILRGSVAHKS-274P15682-Yes22345439
S251109-IQQLEDLVRHMSL-121P24097-Yes22379104
S252170-LMEEIGFLVL-179Q8NFU5-Yes22718630
S253134-LGAALSRLALRPEPPTLR-152Q9UK80-Yes21888622
S2547-FTDCLWTLFL-16Q8N108-13-Yes22384264
S255423-LREESESVLTL-433P20651-Yes16931796
S256368-MENLLNLNL-377Q9WVH5-Yes10377430
S257138-VLRMMVGVNI-147P610232CT9
Yes14769882
S258176-FVKVLEKVDV-185P610232CT9
Yes14769882
S259266-LNIHVGNISLV-276Q12824-Yes11782423
S26089-LPKVLHKRTLGL-100P0C686-Yes11287420
S261209-IHKKFSSIQM-218P40427-Yes17277370
S262134-LQRELQNVQV-143P27987-Yes21148483